PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AHYPO_019355-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Amaranthaceae; Amaranthus
Family MYB
Protein Properties Length: 277aa    MW: 31427.7 Da    PI: 5.1537
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AHYPO_019355-RAgenomeBYUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding27.19.6e-091343131
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartm 31
                     rg W++eEde+l+  ++ +G  +W+++++  
  AHYPO_019355-RA 13 RGLWSPEEDEKLITHITIHGHTSWSSVPKLA 43
                     788************************9975 PP

2Myb_DNA-binding54.42.9e-174790146
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
                     rg++T+eE+  ++++++ lG++ W+ Ia++++ gRt++++k++w++
  AHYPO_019355-RA 47 RGSFTEEEERTIIEVHRILGNR-WAQIAKHLP-GRTDNEVKNFWNS 90
                     89********************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.4E-12442IPR009057Homeodomain-like
PROSITE profilePS500906.771841IPR017877Myb-like domain
SuperFamilySSF466891.68E-191088IPR009057Homeodomain-like
SMARTSM00717471244IPR001005SANT/Myb domain
PfamPF002492.8E-61343IPR001005SANT/Myb domain
CDDcd001676.12E-111689No hitNo description
PROSITE profilePS5129425.0774296IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.8E-224496IPR009057Homeodomain-like
SMARTSM007172.0E-164694IPR001005SANT/Myb domain
PfamPF002493.1E-164790IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 277 aa     Download sequence    Send to blast
MGHQCCSKQK VKRGLWSPEE DEKLITHITI HGHTSWSSVP KLADLRRGSF TEEEERTIIE  60
VHRILGNRWA QIAKHLPGRT DNEVKNFWNS CIKKKLLAQG LDPNTHNLLP TQNKSKTYIN  120
NNASKPSNHH RISSNSTSLN FSDDHQSQSN SLPLEDTEMQ HTINFECNFT DAQFLAPDSM  180
NKSDTITDMD VDNLCGYIID ENPIWGTTPS LENFEQATQE SQVRIPLEET VGVHSDQNFD  240
GSLLSMLSYN YGLGEYPSTN IPNNYQLYSD IGSTMDQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-2113967108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010670059.11e-108PREDICTED: transcription repressor MYB6-like
TrEMBLA0A0J8FNQ11e-108A0A0J8FNQ1_BETVU; Uncharacterized protein
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G12720.19e-66myb domain protein 67